Daily Lookalike Domain Threat Intelligence

Monitor newly registered domains that imitate your brand. Detect phishing infrastructure early, score the risk, and stop attacks before they reach customers.

Check Domain Risk Lookalike Scanner Pricing
79387
Total Lookalikes
285
New in Last 24h
5912
High Risk
4715
Blacklisted
5193
Taken Down
Filters
Clear
Monitor Lookalike Domains Targeting Your Brand

The public feed tracks threats targeting major brands. With Detect, you receive real-time alerts the moment attackers register domains impersonating your brand, clients, or partners — often hours before they're used in phishing campaigns.

  • Monitor your domains, subsidiaries, and partners
  • Instant alerts on new registrations
  • Automated takedown & expert assistance
Detected Lookalike Domains
79250 results

These newly registered domains closely resemble legitimate brands and may be used for phishing, fraud, or malware delivery. Our detection engine continuously analyzes domain registrations, infrastructure signals, and threat intelligence sources and help you block these threats automatically.

Lookalike Target Registrar Risk Website Detected
import-whatsapp.com BLOCKED TAKEN DOWN whatsapp.com - 10 Offline Aug 29, 2026
care-whatsapp.com whatsapp.com Guizhou Zhongyu Zhike Network Technology Co., Ltd. 20 Live Aug 29, 2026
wetransfer-account.com wetransfer.com Global Domain Group LLC 10 Offline Aug 29, 2026
whatsapp-player.com whatsapp.com - 10 Live Aug 29, 2026
restore-whatsapp.com BLOCKED TAKEN DOWN whatsapp.com - 10 Offline Aug 29, 2026
test-whatsapp.com BLOCKED TAKEN DOWN whatsapp.com - 10 Offline Aug 29, 2026
decrypt-whatsapp.com BLOCKED TAKEN DOWN whatsapp.com - 10 Offline Aug 29, 2026
whatsappindex.com whatsapp.com - 40 Live Aug 29, 2026
whatsappai-invest.biz whatsapp.com Dynadot Inc 30 Phishing Aug 29, 2026
policy-whatsapp.com BLOCKED TAKEN DOWN whatsapp.com - 10 Offline Aug 29, 2026
qr-web-whatsapp.com whatsapp.com Guizhou Zhongyu Zhike Network Technology Co., Ltd. 20 Live Aug 29, 2026
wellsfargo-usa.org wellsfargo.com GoDaddy.com, LLC 60 Live Aug 29, 2026
alwaysdiscreetwalmartsweepstake.com walmart.com - 40 Live Aug 29, 2026
t-mobilemy.com t-mobile.com Dynadot Inc 10 Offline Aug 29, 2026
1xbet-mobile.ink t-mobile.com Spaceship, Inc. 20 Live Aug 29, 2026
teosbet-mobilerisimim.top t-mobile.com Dynadot LLC 30 Phishing Aug 29, 2026
spotify-publishers.biz spotify.com - 0 Offline Aug 29, 2026
spotify-publishers.xyz spotify.com Dynadot Inc 10 Offline Aug 29, 2026
squareupoffer.com squareup.com Dynadot Inc 20 Live Aug 29, 2026
lovienspotify.store TAKEN DOWN spotify.com - 0 Offline Aug 29, 2026
spotify-publishers.vip spotify.com Dynadot Inc 10 Offline Aug 29, 2026
spotify-publishers.now spotify.com - 0 Offline Aug 29, 2026
spotifypremiumgratis.net TAKEN DOWN spotify.com - 0 Offline Aug 29, 2026
spotifygratis.net TAKEN DOWN spotify.com - 0 Offline Aug 29, 2026
upgradespotify.net spotify.com Porkbun LLC 45 Live Aug 29, 2026
How exposed are the brands you follow?

See the full picture: which brands attackers target most, which registrars fuel the threat, and how risk scores are shifting over time.

79387 Threats
5912 High Risk
5193 Taken Down
Explore Full Statistics
Detection Trends (30 days)
Emerging Threat Signals

Domains often appear harmless at registration, but become dangerous once attackers configure phishing infrastructure. These domains recently showed risk score increases indicating potential weaponization.

  • sharecanva.com
    40 → 50 +10
    +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)
    1 day, 18 hours ago
  • eƅay.com (xn--eay-43a.com)
    45 → 50 +5
    +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)
    1 day, 17 hours ago
  • coinbase.monster
    25 → 35 +10
    +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)
    3 days, 18 hours ago
  • morganstanley.si
    10 → 15 +5
    +Website Parked (5pts)
    3 days, 14 hours ago
  • dropbox.si
    10 → 15 +5
    +Very Recent Domain (10pts) +Website Parked (5pts)
    4 days, 17 hours ago
  • my-klarna.com
    70 → 75 +5
    +Dangerous Registrar (25pts) +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)
    5 days, 15 hours ago
  • token-whatsapp.com
    10 → 20 +10
    +Very Recent Domain (10pts) +Website Live (10pts)
    4 days, 13 hours ago
  • tradinghsbc.com
    20 → 55 +35
    +Dangerous Email Provider (15pts) +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts)
    1 week, 1 day ago
  • pay-coinbase.com
    40 → 65 +25
    +Blacklisted (30pts) +MX Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)
    3 days, 18 hours ago
  • razorpaypayroll.com
    10 → 50 +40
    +Dangerous Email Provider (10pts) +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts)
    1 week, 2 days ago

Need Professional Domain Protection?

We offers comprehensive brand protection with real-time monitoring, automated takedowns, and expert support.

Learn more here