Daily Lookalike Domain Threat Intelligence
Monitor newly registered domains that imitate your brand. Detect phishing infrastructure early, score the risk, and stop attacks before they reach customers.
Filters
Monitor Lookalike Domains Targeting Your Brand
The public feed tracks threats targeting major brands. With Detect, you receive real-time alerts the moment attackers register domains impersonating your brand, clients, or partners — often hours before they're used in phishing campaigns.
- Monitor your domains, subsidiaries, and partners
- Instant alerts on new registrations
- Automated takedown & expert assistance
Detected Lookalike Domains
These newly registered domains closely resemble legitimate brands and may be used for phishing, fraud, or malware delivery. Our detection engine continuously analyzes domain registrations, infrastructure signals, and threat intelligence sources and help you block these threats automatically.
| Lookalike | Target | Registrar | Risk | Website | Detected |
|---|---|---|---|---|---|
| import-whatsapp.com BLOCKED TAKEN DOWN | whatsapp.com | - | 10 | Offline | Aug 29, 2026 |
| care-whatsapp.com | whatsapp.com | Guizhou Zhongyu Zhike Network Technology Co., Ltd. | 20 | Live | Aug 29, 2026 |
| wetransfer-account.com | wetransfer.com | Global Domain Group LLC | 10 | Offline | Aug 29, 2026 |
| whatsapp-player.com | whatsapp.com | - | 10 | Live | Aug 29, 2026 |
| restore-whatsapp.com BLOCKED TAKEN DOWN | whatsapp.com | - | 10 | Offline | Aug 29, 2026 |
| test-whatsapp.com BLOCKED TAKEN DOWN | whatsapp.com | - | 10 | Offline | Aug 29, 2026 |
| decrypt-whatsapp.com BLOCKED TAKEN DOWN | whatsapp.com | - | 10 | Offline | Aug 29, 2026 |
| whatsappindex.com | whatsapp.com | - | 40 | Live | Aug 29, 2026 |
| whatsappai-invest.biz | whatsapp.com | Dynadot Inc | 30 | Phishing | Aug 29, 2026 |
| policy-whatsapp.com BLOCKED TAKEN DOWN | whatsapp.com | - | 10 | Offline | Aug 29, 2026 |
| qr-web-whatsapp.com | whatsapp.com | Guizhou Zhongyu Zhike Network Technology Co., Ltd. | 20 | Live | Aug 29, 2026 |
| wellsfargo-usa.org | wellsfargo.com | GoDaddy.com, LLC | 60 | Live | Aug 29, 2026 |
| alwaysdiscreetwalmartsweepstake.com | walmart.com | - | 40 | Live | Aug 29, 2026 |
| t-mobilemy.com | t-mobile.com | Dynadot Inc | 10 | Offline | Aug 29, 2026 |
| 1xbet-mobile.ink | t-mobile.com | Spaceship, Inc. | 20 | Live | Aug 29, 2026 |
| teosbet-mobilerisimim.top | t-mobile.com | Dynadot LLC | 30 | Phishing | Aug 29, 2026 |
| spotify-publishers.biz | spotify.com | - | 0 | Offline | Aug 29, 2026 |
| spotify-publishers.xyz | spotify.com | Dynadot Inc | 10 | Offline | Aug 29, 2026 |
| squareupoffer.com | squareup.com | Dynadot Inc | 20 | Live | Aug 29, 2026 |
| lovienspotify.store TAKEN DOWN | spotify.com | - | 0 | Offline | Aug 29, 2026 |
| spotify-publishers.vip | spotify.com | Dynadot Inc | 10 | Offline | Aug 29, 2026 |
| spotify-publishers.now | spotify.com | - | 0 | Offline | Aug 29, 2026 |
| spotifypremiumgratis.net TAKEN DOWN | spotify.com | - | 0 | Offline | Aug 29, 2026 |
| spotifygratis.net TAKEN DOWN | spotify.com | - | 0 | Offline | Aug 29, 2026 |
| upgradespotify.net | spotify.com | Porkbun LLC | 45 | Live | Aug 29, 2026 |
How exposed are the brands you follow?
See the full picture: which brands attackers target most, which registrars fuel the threat, and how risk scores are shifting over time.
Detection Trends (30 days)
Emerging Threat Signals
Domains often appear harmless at registration, but become dangerous once attackers configure phishing infrastructure. These domains recently showed risk score increases indicating potential weaponization.
-
sharecanva.com40 → 50 +10+MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)1 day, 18 hours ago
-
eƅay.com (xn--eay-43a.com)45 → 50 +5+MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)1 day, 17 hours ago
-
coinbase.monster25 → 35 +10+SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)3 days, 18 hours ago
-
morganstanley.si10 → 15 +5+Website Parked (5pts)3 days, 14 hours ago
-
dropbox.si10 → 15 +5+Very Recent Domain (10pts) +Website Parked (5pts)4 days, 17 hours ago
-
my-klarna.com70 → 75 +5+Dangerous Registrar (25pts) +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)5 days, 15 hours ago
-
token-whatsapp.com10 → 20 +10+Very Recent Domain (10pts) +Website Live (10pts)4 days, 13 hours ago
-
tradinghsbc.com20 → 55 +35+Dangerous Email Provider (15pts) +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts)1 week, 1 day ago
-
pay-coinbase.com40 → 65 +25+Blacklisted (30pts) +MX Records (15pts) +Very Recent Domain (10pts) +Website Live (10pts)3 days, 18 hours ago
-
razorpaypayroll.com10 → 50 +40+Dangerous Email Provider (10pts) +MX Records (15pts) +SPF Records (15pts) +Very Recent Domain (10pts)1 week, 2 days ago
Need Professional Domain Protection?
We offers comprehensive brand protection with real-time monitoring, automated takedowns, and expert support.